PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00007.1.g12210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 425aa    MW: 47331.2 Da    PI: 9.1643
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00007.1.g12210.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.15.4e-20168215148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT++Ed+ll+++v+q+G g+W+++a+  g+gR++k+c++rw +yl
  Zjn_sc00007.1.g12210.1.am.mk 168 KGPWTAQEDKLLLEYVRQHGEGRWNSVAKLTGLGRSGKSCRLRWVNYL 215
                                   79********************************************97 PP

2Myb_DNA-binding50.16.1e-16221265147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Zjn_sc00007.1.g12210.1.am.mk 221 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 265
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.314163215IPR017930Myb domain
SuperFamilySSF466891.16E-30166262IPR009057Homeodomain-like
SMARTSM007171.4E-17167217IPR001005SANT/Myb domain
PfamPF002495.6E-19168215IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-25169222IPR009057Homeodomain-like
CDDcd001677.97E-13170215No hitNo description
PROSITE profilePS5129424.933216270IPR017930Myb domain
SMARTSM007174.5E-15220268IPR001005SANT/Myb domain
PfamPF002491.1E-13221265IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-23223268IPR009057Homeodomain-like
CDDcd001679.85E-10225266No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MWRAPSGRGD GDTAMWTPKG SIQIKRWVHA PETGRPPGGF SPMATAAAIR MYRSSEQRLS  60
AANRVARDLD ERSGGQVFRE LDGYPGRLLA VAETWFIPVV ATTGNTKIAG AKLHPQVEAT  120
LSAENPTLSR GRQRGSRRLI SSIVDRQKKR LEMEGQFGWG REEGGWRKGP WTAQEDKLLL  180
EYVRQHGEGR WNSVAKLTGL GRSGKSCRLR WVNYLRPDLK RGKITPQEES VILELHALWG  240
NRWSTIARSL PGRTDNEIKN YWRTHFKKGK PSKNIERARA RFLKQRCEMQ SQLLLQGQEP  300
PPPPQQQQQL EETDHDDAAT GKAAPVACLA QQNEALKMML DMDDLPYQLC PMSSCSSSYH  360
LHGGSGSGSA SAASEGSSED QLQTGYTWGW GSLWNLEGVV DDIDGGACGW DSSFTWLQDQ  420
GLAFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-251682687106B-MYB
1h8a_C2e-2516826827126MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144149DRQKKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-140AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-140AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454181.11e-126hypothetical protein SORBIDRAFT_04g026210
TrEMBLC5XXQ51e-126C5XXQ5_SORBI; Putative uncharacterized protein Sb04g026210
STRINGSb04g026210.11e-126(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.12e-63myb domain protein 79